PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021301-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 218aa    MW: 25341.6 Da    PI: 6.3085
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021301-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85e-2047101357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      k++++++eq++ Le  F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  AHYPO_021301-RA  47 KKRKLSEEQVNMLEMSFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 101
                      45689************************************************95 PP

2HD-ZIP_I/II1216.3e-3947138293
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      kkr+ls+eqv++LE+sF  e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k++E++y++L+++ ++l+ en+rLe+ev +L+++l+e
  AHYPO_021301-RA  47 KKRKLSEEQVNMLEMSFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKIEQEYSKLRNEKENLVVENCRLETEVLSLKDQLNE 138
                      9****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.76342102IPR001356Homeobox domain
SMARTSM003896.4E-1945106IPR001356Homeobox domain
SuperFamilySSF466897.7E-1846112IPR009057Homeodomain-like
CDDcd000866.13E-1647103No hitNo description
PfamPF000462.4E-1747101IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-2049109IPR009057Homeodomain-like
PRINTSPR000311.4E-57382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000311.4E-58298IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MHEKDDSMGL ISQLYSGLYT QMAPQQGEKP KRRRRKKNKS EESNLAKKRK LSEEQVNMLE  60
MSFGCEHKLE SERKDRLASE LGLDPRQVAV WFQNRRARWK NKKIEQEYSK LRNEKENLVV  120
ENCRLETEVL SLKDQLNEAK KEIEKLANER SSAISSTADN ISSNSPSSSL TTMDYHPNLI  180
NPQILVEEQF GMEGCFYDTL FYVPENVPNV DWVDLYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12936PKRRRRKK
23035KRRRRK
33036KRRRRKK
43249RRRKKNKSEESNLAKKRK
53449RKKNKSEESNLAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681120.12e-97PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU702e-66ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A0J8C9L62e-97A0A0J8C9L6_BETVU; Uncharacterized protein
STRINGPOPTR_0005s12760.14e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-58homeobox protein 40